PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009618869.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 353aa    MW: 40317 Da    PI: 5.0368
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009618869.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++++G g+W+++++  g+ R++k+c++rw +yl
   XP_009618869.1 14 KGLWSPEEDEKLCNYITKFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding52.51.1e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE++++++++++lG++ W+ Ia+ ++ gRt++++k++w++yl
   XP_009618869.1  67 RGMFSQEEEDIILNLHELLGNR-WAQIAAQLP-GRTDNEIKNFWNSYL 112
                      788*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.467961IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-24964IPR009057Homeodomain-like
SuperFamilySSF466892.2E-2912108IPR009057Homeodomain-like
SMARTSM007174.0E-121363IPR001005SANT/Myb domain
PfamPF002491.4E-141461IPR001005SANT/Myb domain
CDDcd001672.99E-101761No hitNo description
PROSITE profilePS5129426.02862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2665117IPR009057Homeodomain-like
SMARTSM007171.8E-1566114IPR001005SANT/Myb domain
PfamPF002491.3E-1567112IPR001005SANT/Myb domain
CDDcd001671.70E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGRHSVFVKE KLRKGLWSPE EDEKLCNYIT KFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQEEEDIILN LHELLGNRWA QIAAQLPGRT DNEIKNFWNS YLKKKLIKQG  120
IDPNTHKPLS ENQVRNETDC TDKASMLLIP QLPNMSISAK MEQPFHLSET SVDCEANRQL  180
TDASRNQLVS KQVFDPLFLY EFQANDDPSE YNSELLGQCQ QNLRPYDHQN QIEGNPNFGF  240
CSMPSLTNFE HGHMTETEFS DSSSSIMSLL YTSEAKESSS NSSNMNNHHN AAEIQMNEMV  300
GNPQDLSWGS ENKIDSLFQY PYGGIKNEED FSNNPLSSLS EDTCGENLVF HHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29121165108B-MYB
1h8a_C1e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618869.10.0PREDICTED: myb-related protein 330-like isoform X2
RefseqXP_016437675.10.0PREDICTED: myb-related protein 330-like
TrEMBLM1CKU41e-160M1CKU4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000696441e-160(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-75myb domain protein 86